CacheBy
Atlas Antibodies Anti-CACNG6 Antibody
원본

Atlas Antibodies Anti-CACNG6 Antibody

상품 한눈에 보기

Human CACNG6 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합하며, 고순도 및 높은 특이성을 제공. PBS/glycerol buffer에 보존되어 안정성이 우수함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056615-100 Anti-CACNG6 Antibody, calcium channel, voltage-dependent, gamma subunit 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056615-25 Anti-CACNG6 Antibody, calcium channel, voltage-dependent, gamma subunit 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CACNG6 Antibody

Anti-CACNG6 Antibody

Target: calcium channel, voltage-dependent, gamma subunit 6
Type: Polyclonal Antibody against Human CACNG6

  • ICC (Immunocytochemistry) 등 다양한 면역학적 응용에 적합

Product Description

This is a rabbit polyclonal antibody raised against the human CACNG6 protein. The antibody is affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein calcium channel, voltage-dependent, gamma subunit 6
Target Gene CACNG6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTK
Verified Species Reactivity Human
Interspecies Identity Mouse (91%), Rat (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.