
원본
Atlas Antibodies Anti-CACNG6 Antibody
상품 한눈에 보기
Human CACNG6 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합하며, 고순도 및 높은 특이성을 제공. PBS/glycerol buffer에 보존되어 안정성이 우수함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056615-100 Anti-CACNG6 Antibody, calcium channel, voltage-dependent, gamma subunit 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056615-25 Anti-CACNG6 Antibody, calcium channel, voltage-dependent, gamma subunit 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CACNG6 Antibody
Anti-CACNG6 Antibody
Target: calcium channel, voltage-dependent, gamma subunit 6
Type: Polyclonal Antibody against Human CACNG6
Recommended Applications
- ICC (Immunocytochemistry) 등 다양한 면역학적 응용에 적합
Product Description
This is a rabbit polyclonal antibody raised against the human CACNG6 protein. The antibody is affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium channel, voltage-dependent, gamma subunit 6 |
| Target Gene | CACNG6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (91%), Rat (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



