
Atlas Antibodies Anti-CACNA2D2 Antibody
인간 CACNA2D2 단백질을 인식하는 폴리클로날 항체로, IHC 기반 정량 및 RNA-seq 데이터 비교를 통한 정교한 발현 검증에 적합. 토끼 유래 IgG 항체이며, PrEST 항원 친화 정제 방식으로 높은 특이도와 재현성을 보장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CACNA2D2 Antibody
Target: calcium channel, voltage-dependent, alpha 2/delta subunit 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CACNA2D2.
Alternative Gene Names
KIAA0558
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium channel, voltage-dependent, alpha 2/delta subunit 2 |
| Target Gene | CACNA2D2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000010066 (99%)
- Rat ENSRNOG00000015835 (98%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CACNB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CACNA2D1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CACNA2D2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CACNA2D1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CACNA1S Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|