CacheBy
Atlas Antibodies Anti-CACNA2D2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CACNA2D2 Antibody

상품 한눈에 보기

인간 CACNA2D2 단백질을 인식하는 폴리클로날 항체로, IHC 기반 정량 및 RNA-seq 데이터 비교를 통한 정교한 발현 검증에 적합. 토끼 유래 IgG 항체이며, PrEST 항원 친화 정제 방식으로 높은 특이도와 재현성을 보장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034771-100 Anti-CACNA2D2 Antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034771-25 Anti-CACNA2D2 Antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CACNA2D2 Antibody

Anti-CACNA2D2 Antibody

Target: calcium channel, voltage-dependent, alpha 2/delta subunit 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human CACNA2D2.


Alternative Gene Names

KIAA0558

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein calcium channel, voltage-dependent, alpha 2/delta subunit 2
Target Gene CACNA2D2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000010066 (99%)
  • Rat ENSRNOG00000015835 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.