
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CACNA2D2 Antibody
상품 한눈에 보기
인간 CACNA2D2 단백질을 인식하는 폴리클로날 항체로, IHC 기반 정량 및 RNA-seq 데이터 비교를 통한 정교한 발현 검증에 적합. 토끼 유래 IgG 항체이며, PrEST 항원 친화 정제 방식으로 높은 특이도와 재현성을 보장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034771-100 Anti-CACNA2D2 Antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034771-25 Anti-CACNA2D2 Antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CACNA2D2 Antibody
Anti-CACNA2D2 Antibody
Target: calcium channel, voltage-dependent, alpha 2/delta subunit 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CACNA2D2.
Alternative Gene Names
KIAA0558
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium channel, voltage-dependent, alpha 2/delta subunit 2 |
| Target Gene | CACNA2D2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000010066 (99%)
- Rat ENSRNOG00000015835 (98%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



