
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CACNA1S Antibody
상품 한눈에 보기
인체 CACNA1S 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 기반의 정교한 Orthogonal 검증을 거침. Rabbit 유래 IgG 형태이며, PrEST 항원으로 친화정제됨. 인체 반응성이 검증된 연구용 시약.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056815-100 Anti-CACNA1S Antibody, calcium channel, voltage-dependent, L type, alpha 1S subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056815-25 Anti-CACNA1S Antibody, calcium channel, voltage-dependent, L type, alpha 1S subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CACNA1S Antibody
Anti-CACNA1S Antibody
Target: calcium channel, voltage-dependent, L type, alpha 1S subunit
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human CACNA1S.
Alternative Gene Names
CACNL1A3, Cav1.1, HOKPP, hypoPP, MHS5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium channel, voltage-dependent, L type, alpha 1S subunit |
| Target Gene | CACNA1S |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (70%), Rat (67%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
ESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSSVHYEREFPEETETPATRGRALGQPCRVLGPHSKPCVENotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



