CacheBy
Atlas Antibodies Anti-CACNA1S Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CACNA1S Antibody

상품 한눈에 보기

인체 CACNA1S 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 기반의 정교한 Orthogonal 검증을 거침. Rabbit 유래 IgG 형태이며, PrEST 항원으로 친화정제됨. 인체 반응성이 검증된 연구용 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056815-100 Anti-CACNA1S Antibody, calcium channel, voltage-dependent, L type, alpha 1S subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056815-25 Anti-CACNA1S Antibody, calcium channel, voltage-dependent, L type, alpha 1S subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CACNA1S Antibody

Anti-CACNA1S Antibody

Target: calcium channel, voltage-dependent, L type, alpha 1S subunit
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human CACNA1S.


Alternative Gene Names

CACNL1A3, Cav1.1, HOKPP, hypoPP, MHS5

Open Datasheet


Target Information

항목 내용
Target Protein calcium channel, voltage-dependent, L type, alpha 1S subunit
Target Gene CACNA1S
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (70%), Rat (67%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

ESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSSVHYEREFPEETETPATRGRALGQPCRVLGPHSKPCVE

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.