Atlas Antibodies Anti-CACNA2D1 Antibody
인간 CACNA2D1 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. 정제된 Rabbit IgG 항체이며, Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PBS/glycerol 버퍼에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-CACNA2D1 Antibody
Anti-CACNA2D1 Antibody
Target: calcium channel, voltage-dependent, alpha 2/delta subunit 1
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CACNA2D1
Alternative Gene Names
CACNA2, CACNL2A, LINC01112, lncRNA-N3, MHS3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium channel, voltage-dependent, alpha 2/delta subunit 1 |
| Target Gene | CACNA2D1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse 98%, Rat 98% |
Antigen Sequence:
QPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARSKKGKMKDSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.