CacheBy
Atlas Antibodies Anti-CA8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CA8 Antibody

상품 한눈에 보기

Human CA8 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간과 마우스에 반응성이 검증되었습니다. 40% 글리세롤 PBS 버퍼로 안정화되어 장기 보관에 용이합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024748-100 Anti-CA8 Antibody, carbonic anhydrase VIII 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024748-25 Anti-CA8 Antibody, carbonic anhydrase VIII 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CA8 Antibody

Anti-CA8 Antibody

Target Information

  • Target Protein: Carbonic anhydrase VIII
  • Target Gene: CA8
  • Alternative Gene Names: CALS, CARP

Product Description

Polyclonal antibody against human CA8.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000005669 100%
Mouse ENSMUSG00000041261 99%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.