
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CAAP1 Antibody
상품 한눈에 보기
Human CAAP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Recombinant expression으로 검증되었으며, Affinity purification으로 높은 특이성과 재현성을 제공합니다. Glycerol 기반 buffer에 보존되어 장기 보관이 용이합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA024029-100 Anti-CAAP1 Antibody, caspase activity and apoptosis inhibitor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024029-25 Anti-CAAP1 Antibody, caspase activity and apoptosis inhibitor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CAAP1 Antibody
Anti-CAAP1 Antibody
Target: caspase activity and apoptosis inhibitor 1 (CAAP1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human CAAP1
Alternative Gene Names
C9orf82, CAAP, FLJ13657
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
CNEEAAAPEAPENTVQSEAGQIDDLEKDIEKSVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQLELLELEMRARAIKALMKAGDI
Species Reactivity
- Verified Reactivity: Human
- Interspecies Identity:
- Mouse ENSMUSG00000028578 (86%)
- Rat ENSRNOG00000007299 (83%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



