Atlas Antibodies Anti-CA6 Antibody

상품 한눈에 보기

인체 CA6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증을 통해 신뢰성 확보. 재조합 단백질 기반 PrEST 항원으로 특이적 결합. 인체 반응성 확인, 고순도 친화 정제 방식으로 제조.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028692-100 Anti-CA6 Antibody, carbonic anhydrase VI 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028692-25 Anti-CA6 Antibody, carbonic anhydrase VI 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Carbonic anhydrase VI
Target Gene: CA6
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYL

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000028972	60%
Rat	ENSRNOG00000021355	49%

Polyclonal Antibody against Human CA6

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet (MSDS)
Open Datasheet