Atlas Antibodies Anti-C9orf64 Antibody

상품 한눈에 보기

인간 C9orf64 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증된 반응성을 가지며, 40% 글리세롤 PBS 버퍼에 보존됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054903-100 Anti-C9orf64 Antibody, chromosome 9 open reading frame 64 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054903-25 Anti-C9orf64 Antibody, chromosome 9 open reading frame 64 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C9orf64 Antibody

Anti-C9orf64 Antibody

Target Information

Target Protein: Chromosome 9 open reading frame 64
Target Gene: C9orf64
Alternative Gene Names: MGC10999

Product Description

Polyclonal antibody against human C9orf64.

Recommended Applications

면역조직화학 (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000019232 (82%)
Mouse ENSMUSG00000021550 (79%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand