
Atlas Antibodies Anti-C9orf64 Antibody
인간 C9orf64 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증된 반응성을 가지며, 40% 글리세롤 PBS 버퍼에 보존됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C9orf64 Antibody
Target Information
- Target Protein: Chromosome 9 open reading frame 64
- Target Gene: C9orf64
- Alternative Gene Names: MGC10999
Product Description
Polyclonal antibody against human C9orf64.
Recommended Applications
면역조직화학 (IHC)
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000019232 (82%)
- Mouse ENSMUSG00000021550 (79%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet
Open Datasheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C9orf66 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf64 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf64 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf50 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf40 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|