CacheBy
Atlas Antibodies Anti-C9orf50 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C9orf50 Antibody

상품 한눈에 보기

인간 C9orf50 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 오쏘고날 검증에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, RNA-seq 데이터 기반 단백질 발현 검증 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026743-100 Anti-C9orf50 Antibody, chromosome 9 open reading frame 50 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026743-25 Anti-C9orf50 Antibody, chromosome 9 open reading frame 50 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C9orf50 Antibody

Anti-C9orf50 Antibody

Target: chromosome 9 open reading frame 50 (C9orf50)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C9orf50.


Alternative Gene Names

  • FLJ35803

Target Information

항목 내용
Target Protein chromosome 9 open reading frame 50
Target Gene C9orf50
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000018486 (49%), Mouse ENSMUSG00000044320 (47%)

Antigen Sequence:
HSQFTTVRKANQPHGAQVPRLKAALTHNPSGEGSRPCRQRCPFRVRFADETLQDTTLRYWERRRSVQQSVIVNQKAALPVASERVFGSVGK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.