CacheBy
Atlas Antibodies Anti-C9orf66 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C9orf66 Antibody

상품 한눈에 보기

Human C9orf66 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. 재조합 단백질을 이용한 검증을 거쳤으며, 높은 특이성과 신뢰성을 제공합니다. FLJ31158 유전자 대체명 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035652-100 Anti-C9orf66 Antibody, chromosome 9 open reading frame 66 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035652-25 Anti-C9orf66 Antibody, chromosome 9 open reading frame 66 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C9orf66 Antibody

Anti-C9orf66 Antibody

Target: chromosome 9 open reading frame 66 (C9orf66)
Type: Polyclonal Antibody against Human C9orf66
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Alternative Gene Names

  • FLJ31158

Open Datasheet (PDF)


Antigen and Sequence Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEDLAGPSAGAAARPAAPPPQPREPGA

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000046000 35%
Mouse ENSMUSG00000061028 34%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.