
Atlas Antibodies Anti-C8orf34 Antibody
상품 한눈에 보기
Human C8orf34 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Rat 및 Mouse와 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C8orf34 Antibody
Target: chromosome 8 open reading frame 34 (C8orf34)
Type: Polyclonal Antibody against Human C8orf34
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against the human C8orf34 protein.
Alternative Gene Names
- vest-1
- VEST1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 8 open reading frame 34 |
| Target Gene | C8orf34 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000005375 (82%), Mouse ENSMUSG00000057715 (81%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C8orf44 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8orf46 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8orf34 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8orf37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8orf33 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.