CacheBy
Atlas Antibodies Anti-C8orf34 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C8orf34 Antibody

상품 한눈에 보기

Human C8orf34 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Rat 및 Mouse와 높은 서열 유사성을 가집니다.

카탈로그번호
HPA053065-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053065-100 Anti-C8orf34 Antibody, chromosome 8 open reading frame 34 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053065-25 Anti-C8orf34 Antibody, chromosome 8 open reading frame 34 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8orf34 Antibody

Anti-C8orf34 Antibody

Target: chromosome 8 open reading frame 34 (C8orf34)
Type: Polyclonal Antibody against Human C8orf34


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against the human C8orf34 protein.


Alternative Gene Names

  • vest-1
  • VEST1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 8 open reading frame 34
Target Gene C8orf34
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRS

Species Reactivity

항목 내용
Verified Reactivity Human
Ortholog Identity Rat ENSRNOG00000005375 (82%), Mouse ENSMUSG00000057715 (81%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.