CacheBy
Atlas Antibodies Anti-C8orf33 Antibody
원본

Atlas Antibodies Anti-C8orf33 Antibody

상품 한눈에 보기

인간 C8orf33 단백질을 표적으로 하는 폴리클로날 항체. Western blot 및 IHC에 적합하며, 재조합 발현 검증 완료. 토끼에서 생산된 IgG로 고순도 친화 정제. 인간에 높은 반응성, 생물학적 연구용으로 최적화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026104-100 Anti-C8orf33 Antibody, chromosome 8 open reading frame 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026104-25 Anti-C8orf33 Antibody, chromosome 8 open reading frame 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8orf33 Antibody

Anti-C8orf33 Antibody

Target: chromosome 8 open reading frame 33 (C8orf33)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human C8orf33.


Alternative Gene Names

  • FLJ20989

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 8 open reading frame 33
Target Gene C8orf33
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (77%), Rat (72%)

Antigen Sequence:

LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.