CacheBy
Atlas Antibodies Anti-C8orf37 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C8orf37 Antibody

상품 한눈에 보기

Human C8orf37 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 ICC 응용에 적합하며 PrEST 항원으로 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 40% glycerol 기반 PBS buffer를 사용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024198-100 Anti-C8orf37 Antibody, chromosome 8 open reading frame 37 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024198-25 Anti-C8orf37 Antibody, chromosome 8 open reading frame 37 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8orf37 Antibody

Anti-C8orf37 Antibody

Target: chromosome 8 open reading frame 37
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human C8orf37.


Alternative Gene Names

CORD16, FLJ30600, RP64

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 8 open reading frame 37
Target Gene C8orf37
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (76%), Rat (75%)

Antigen Sequence:
MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.