
Atlas Antibodies Anti-C8orf33 Antibody
상품 한눈에 보기
Human C8orf33 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB(recombinant expression) 검증 완료. 고순도 affinity purification 방식으로 제조되었으며, 다양한 종에서 교차 반응성 확인됨. 연구용으로 최적화된 고품질 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C8orf33 Antibody
Target: chromosome 8 open reading frame 33 (C8orf33)
Type: Polyclonal Antibody against Human C8orf33
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human C8orf33 protein.
Alternative Gene Names
- FLJ20989
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 8 open reading frame 33 |
| Target Gene | C8orf33 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000063236 | 77% |
| Rat | ENSRNOG00000034107 | 72% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C8orf33 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8orf34 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8orf33 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8orf22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.