CacheBy
Atlas Antibodies Anti-C8orf33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C8orf33 Antibody

상품 한눈에 보기

Human C8orf33 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB(recombinant expression) 검증 완료. 고순도 affinity purification 방식으로 제조되었으며, 다양한 종에서 교차 반응성 확인됨. 연구용으로 최적화된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024812-100 Anti-C8orf33 Antibody, chromosome 8 open reading frame 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024812-25 Anti-C8orf33 Antibody, chromosome 8 open reading frame 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8orf33 Antibody

Anti-C8orf33 Antibody

Target: chromosome 8 open reading frame 33 (C8orf33)
Type: Polyclonal Antibody against Human C8orf33
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, recombinant expression validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody raised in rabbit against human C8orf33 protein.


Alternative Gene Names

  • FLJ20989

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 8 open reading frame 33
Target Gene C8orf33
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000063236 77%
Rat ENSRNOG00000034107 72%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.