Atlas Antibodies Anti-C8B Antibody

상품 한눈에 보기

인체 C8B 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. 인간 반응성 검증 완료, RNA-seq 기반 Orthogonal Validation 적용.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023694-100 Anti-C8B Antibody, complement component 8, beta polypeptide 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023694-25 Anti-C8B Antibody, complement component 8, beta polypeptide 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Complement component 8, beta polypeptide (C8B)
Supplier: Atlas Antibodies

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Western Blot (WB)

Polyclonal antibody against human C8B.

항목	내용
Target Protein	Complement component 8, beta polypeptide
Target Gene	C8B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

종	유전자 ID	항원 서열 일치율
Mouse	ENSMUSG00000029656	78%
Rat	ENSRNOG00000007639	78%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand