
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C8B Antibody
상품 한눈에 보기
인체 C8B 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. 인간 반응성 검증 완료, RNA-seq 기반 Orthogonal Validation 적용.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023694-100 Anti-C8B Antibody, complement component 8, beta polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023694-25 Anti-C8B Antibody, complement component 8, beta polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C8B Antibody
Anti-C8B Antibody
Target: Complement component 8, beta polypeptide (C8B)
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Western Blot (WB)
Product Description
Polyclonal antibody against human C8B.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Complement component 8, beta polypeptide |
| Target Gene | C8B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000029656 | 78% |
| Rat | ENSRNOG00000007639 | 78% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



