Atlas Antibodies Anti-C7orf57 Antibody

상품 한눈에 보기

Human C7orf57 단백질을 인식하는 토끼 폴리클로날 항체. IHC 기반 정교한 Orthogonal Validation 수행. PrEST 항원으로 친화 정제되어 높은 특이도와 재현성 제공. RNA-seq 데이터와 비교하여 단백질 발현 검증 가능.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021286-100 Anti-C7orf57 Antibody, chromosome 7 open reading frame 57 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021286-25 Anti-C7orf57 Antibody, chromosome 7 open reading frame 57 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C7orf57 Antibody

Anti-C7orf57 Antibody

Target: chromosome 7 open reading frame 57 (C7orf57)
Validated for: Orthogonal validation of protein expression using IHC, compared to RNA-seq data from high and low expression tissues.

Product Description

Polyclonal antibody against human C7orf57.
Validated by orthogonal comparison of IHC and RNA-seq data.

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	chromosome 7 open reading frame 57
Target Gene	C7orf57
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA
Verified Species Reactivity	Human
Ortholog Identity	Mouse ENSMUSG00000040978 (59%), Rat ENSRNOG00000037632 (57%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety Information	Material Safety Data Sheet