
Atlas Antibodies Anti-C7orf57 Antibody
Human C7orf57 단백질을 인식하는 토끼 폴리클로날 항체. IHC 기반 정교한 Orthogonal Validation 수행. PrEST 항원으로 친화 정제되어 높은 특이도와 재현성 제공. RNA-seq 데이터와 비교하여 단백질 발현 검증 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C7orf57 Antibody
Target: chromosome 7 open reading frame 57 (C7orf57)
Validated for: Orthogonal validation of protein expression using IHC, compared to RNA-seq data from high and low expression tissues.
Product Description
Polyclonal antibody against human C7orf57.
Validated by orthogonal comparison of IHC and RNA-seq data.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 7 open reading frame 57 |
| Target Gene | C7orf57 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000040978 (59%), Rat ENSRNOG00000037632 (57%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Information | Material Safety Data Sheet |
Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C7orf73 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C8G Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C7orf57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C7orf50 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C7orf49 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|