CacheBy
Atlas Antibodies Anti-C8G Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C8G Antibody

상품 한눈에 보기

Human C8G 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 반응하며 마우스·랫과 높은 서열 유사성 보유. 안정한 PBS/glycerol 버퍼에 보존제 포함.

카탈로그번호
HPA046269-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046269-100 Anti-C8G Antibody, complement component 8, gamma polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046269-25 Anti-C8G Antibody, complement component 8, gamma polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8G Antibody

Anti-C8G Antibody

Target Information

  • Target Protein: Complement component 8, gamma polypeptide
  • Target Gene: C8G
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
STIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAET

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000015083 (81%)
  • Rat ENSRNOG00000028701 (78%)

Product Description

Polyclonal antibody against human C8G.

Open Datasheet (PDF)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.