CacheBy
Atlas Antibodies Anti-C7orf49 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C7orf49 Antibody

상품 한눈에 보기

Human C7orf49 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit host, IgG isotype이며, PrEST 항원을 이용해 Affinity purification되었습니다. Recombinant expression validation 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020060-100 Anti-C7orf49 Antibody, chromosome 7 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020060-25 Anti-C7orf49 Antibody, chromosome 7 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C7orf49 Antibody

Anti-C7orf49 Antibody

Target: chromosome 7 open reading frame 49 (C7orf49)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C7orf49.


Alternative Gene Names

FLJ22450, FLJ27285, MGC5242, MRI

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein chromosome 7 open reading frame 49
Target Gene C7orf49
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREI
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000026958 (71%), Mouse ENSMUSG00000046806 (70%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.