CacheBy
Atlas Antibodies Anti-C6orf141 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf141 Antibody

상품 한눈에 보기

인간 C6orf141 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤과 PBS 완충액에 보존되어 장기 안정성 우수. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036199-100 Anti-C6orf141 Antibody, chromosome 6 open reading frame 141 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036199-25 Anti-C6orf141 Antibody, chromosome 6 open reading frame 141 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf141 Antibody

Anti-C6orf141 Antibody

Target: Chromosome 6 open reading frame 141 (C6orf141)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C6orf141.
Alternative Gene Name: MGC46457

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome 6 open reading frame 141
Target Gene C6orf141
Alternative Gene Names MGC46457
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000060518 (36%), Mouse ENSMUSG00000024330 (34%)

Antigen Sequence:
FARMETRGPQGAANPMDSSRSLGDLGPFPREVGRGAPLAPGARNPATAGASRSQGGGHEDRTADRALGP


Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.