
Atlas Antibodies Anti-C6orf141 Antibody
상품 한눈에 보기
인간 C6orf141 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤과 PBS 완충액에 보존되어 장기 안정성 우수. 인간에 대한 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C6orf141 Antibody
Target: Chromosome 6 open reading frame 141 (C6orf141)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C6orf141.
Alternative Gene Name: MGC46457
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 6 open reading frame 141 |
| Target Gene | C6orf141 |
| Alternative Gene Names | MGC46457 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000060518 (36%), Mouse ENSMUSG00000024330 (34%) |
Antigen Sequence:
FARMETRGPQGAANPMDSSRSLGDLGPFPREVGRGAPLAPGARNPATAGASRSQGGGHEDRTADRALGP
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C6orf15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf163 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf141 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf120 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf136 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.