
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C6orf15 Antibody
상품 한눈에 보기
Human C6orf15 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제되었습니다. IHC 등 다양한 응용에 적합하며, STG로도 알려진 C6orf15 단백질 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001436-100 Anti-C6orf15 Antibody, chromosome 6 open reading frame 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001436-25 Anti-C6orf15 Antibody, chromosome 6 open reading frame 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C6orf15 Antibody
Anti-C6orf15 Antibody
Target: chromosome 6 open reading frame 15 (C6orf15)
Alternative Gene Name: STG
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human C6orf15.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 6 open reading frame 15 |
| Target Gene | C6orf15 |
| Alternative Gene Name | STG |
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINR
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000039269 (47%)
- Rat ENSRNOG00000007925 (26%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Related Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



