CacheBy
Atlas Antibodies Anti-C6orf15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-C6orf15 Antibody

상품 한눈에 보기

Human C6orf15 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제되었습니다. IHC 등 다양한 응용에 적합하며, STG로도 알려진 C6orf15 단백질 연구에 활용 가능합니다.

브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001436-100 Anti-C6orf15 Antibody, chromosome 6 open reading frame 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001436-25 Anti-C6orf15 Antibody, chromosome 6 open reading frame 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C6orf15 Antibody

Anti-C6orf15 Antibody

Target: chromosome 6 open reading frame 15 (C6orf15)
Alternative Gene Name: STG
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human C6orf15.

Target Information

항목 내용
Target Protein chromosome 6 open reading frame 15
Target Gene C6orf15
Alternative Gene Name STG

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    PEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINR

Species Reactivity

종 반응성
Human Verified

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000039269 (47%)
  • Rat ENSRNOG00000007925 (26%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-C6orf203 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-C6orf163 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-C6orf163 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-C6orf141 Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.