CacheBy
Atlas Antibodies Anti-C6orf163 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf163 Antibody

상품 한눈에 보기

인간 C6orf163 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 글리세롤 및 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044797-100 Anti-C6orf163 Antibody, chromosome 6 open reading frame 163 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044797-25 Anti-C6orf163 Antibody, chromosome 6 open reading frame 163 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf163 Antibody

Anti-C6orf163 Antibody

Target: Chromosome 6 open reading frame 163 (C6orf163)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C6orf163.

Open Datasheet (PDF)

Target Information

  • Target Protein: Chromosome 6 open reading frame 163
  • Target Gene: C6orf163
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
AVCNKIIPPAPFGKTFKRIHEYKPLKTRFYTHKDILDIGANILKKEEQFQEDILREHIAKAEAEVWAQANERQKQAVEKALEEAND

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000009178 (72%)
  • Mouse ENSMUSG00000071015 (70%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Verified Reactivity Human
Storage Store at recommended conditions; gently mix before use
Notes Optimal concentrations and conditions should be determined by the user

Material Safety Data Sheet: MSDS for Sodium Azide


제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.