
Atlas Antibodies Anti-C6 Antibody
상품 한눈에 보기
Human C6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. Human에 반응하며, 최적 조건은 사용자가 실험에 맞게 조정 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C6 Antibody
Target Information
- Target Protein: Complement component 6
- Target Gene: C6
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA
Product Description
Polyclonal antibody against human C6, suitable for immunohistochemistry (IHC) and Western blot (WB) applications.
Open Datasheet
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat: ENSRNOG00000024115 (74%)
- Mouse: ENSMUSG00000022181 (66%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C6orf118 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf106 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf106 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.