AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C6orf106 Antibody
상품 한눈에 보기
Human C6orf106 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot 및 IHC에 적합합니다. PrEST 항원으로 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤/PBS 완충액에 보존제로 sodium azide를 포함합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034489-100 Anti-C6orf106 Antibody, chromosome 6 open reading frame 106 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034489-25 Anti-C6orf106 Antibody, chromosome 6 open reading frame 106 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C6orf106 Antibody
Anti-C6orf106 Antibody
Target: chromosome 6 open reading frame 106 (C6orf106)
Type: Polyclonal Antibody against Human C6orf106
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human C6orf106 protein.
Alternative Gene Names
dJ391O22.4, FLJ22195
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 6 open reading frame 106 |
| Target Gene | C6orf106 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMS |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000056692 | 100% |
| Rat | ENSRNOG00000038883 | 99% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.