CacheBy
Atlas Antibodies Anti-C6orf106 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf106 Antibody

상품 한눈에 보기

Human C6orf106 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인간에서 검증되었으며, 생쥐 및 랫트와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034490-100 Anti-C6orf106 Antibody, chromosome 6 open reading frame 106 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034490-25 Anti-C6orf106 Antibody, chromosome 6 open reading frame 106 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf106 Antibody

Anti-C6orf106 Antibody

Target: chromosome 6 open reading frame 106 (C6orf106)
Type: Polyclonal Antibody against Human C6orf106


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody raised in rabbit against human C6orf106 protein.


Alternative Gene Names

  • dJ391O22.4
  • FLJ22195

Open Datasheet (PDF)


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000056692 100%
Rat ENSRNOG00000038883 99%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.