
Atlas Antibodies Anti-C3orf52 Antibody
상품 한눈에 보기
인간 C3orf52 단백질을 인식하는 폴리클로날 항체로, 면역세포 염색 등 다양한 연구용으로 적합함. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가짐. 고순도 Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C3orf52 Antibody
Target: Chromosome 3 open reading frame 52
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human C3orf52.
Alternative Gene Names
- FLJ23186
- TTMP
Target Information
- Target Protein: Chromosome 3 open reading frame 52
- Target Gene: C3orf52
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000033187 | 50% |
| Rat | ENSRNOG00000022136 | 47% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C3orf62 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf67 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf52 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.