CacheBy
Atlas Antibodies Anti-C3orf52 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3orf52 Antibody

상품 한눈에 보기

인간 C3orf52 단백질을 인식하는 폴리클로날 항체로, 면역세포 염색 등 다양한 연구용으로 적합함. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가짐. 고순도 Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공함.

카탈로그번호
HPA008119-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008119-100 Anti-C3orf52 Antibody, chromosome 3 open reading frame 52 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008119-25 Anti-C3orf52 Antibody, chromosome 3 open reading frame 52 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3orf52 Antibody

Anti-C3orf52 Antibody

Target: Chromosome 3 open reading frame 52
Supplier: Atlas Antibodies


Immunocytochemistry (ICC)


Product Description

Polyclonal antibody against Human C3orf52.


Alternative Gene Names

  • FLJ23186
  • TTMP

Open Datasheet


Target Information

  • Target Protein: Chromosome 3 open reading frame 52
  • Target Gene: C3orf52
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000033187 50%
Rat ENSRNOG00000022136 47%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.