
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C3orf52 Antibody
상품 한눈에 보기
인간 C3orf52 단백질을 인식하는 폴리클로날 항체로, 면역세포 염색 등 다양한 연구용으로 적합함. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가짐. 고순도 Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공함.
- 카탈로그번호
- HPA008119-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA008119-100 Anti-C3orf52 Antibody, chromosome 3 open reading frame 52 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008119-25 Anti-C3orf52 Antibody, chromosome 3 open reading frame 52 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C3orf52 Antibody
Anti-C3orf52 Antibody
Target: Chromosome 3 open reading frame 52
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human C3orf52.
Alternative Gene Names
- FLJ23186
- TTMP
Target Information
- Target Protein: Chromosome 3 open reading frame 52
- Target Gene: C3orf52
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000033187 | 50% |
| Rat | ENSRNOG00000022136 | 47% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



