CacheBy
Atlas Antibodies Anti-C3orf52 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3orf52 Antibody

상품 한눈에 보기

Human C3orf52 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존. 인간 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011968-100 Anti-C3orf52 Antibody, chromosome 3 open reading frame 52 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011968-25 Anti-C3orf52 Antibody, chromosome 3 open reading frame 52 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3orf52 Antibody

Anti-C3orf52 Antibody

Target: chromosome 3 open reading frame 52 (C3orf52)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human C3orf52 protein.

Alternative Gene Names

FLJ23186, TTMP

  • Immunocytochemistry (ICC)

Target Information

항목 내용
Target Protein chromosome 3 open reading frame 52
Target Gene C3orf52
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000033187 (50%), Rat ENSRNOG00000022136 (47%)

Antigen Sequence:
AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.