CacheBy
Atlas Antibodies Anti-C3orf62 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3orf62 Antibody

상품 한눈에 보기

Human C3orf62 단백질을 표적으로 하는 토끼 폴리클로날 항체. WB 및 ICC에 적합하며, 재조합 발현 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 인간과 높은 종 특이성을 가짐. 40% 글리세롤/PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043328-100 Anti-C3orf62 Antibody, chromosome 3 open reading frame 62 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043328-25 Anti-C3orf62 Antibody, chromosome 3 open reading frame 62 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3orf62 Antibody

Anti-C3orf62 Antibody

Target: chromosome 3 open reading frame 62 (C3orf62)
Supplier: Atlas Antibodies


  • Western Blot (WB): Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C3orf62.


Alternative Gene Names

  • FLJ43654

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 3 open reading frame 62
Target Gene C3orf62
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CAPENENPAFATNHAPVNAKPHALCPERKPLTSKENVLMHSSILAPERESWRTAGEGENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMIDH
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000046155 (79%), Mouse ENSMUSG00000032611 (74%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Recombinant Expression Validation
Recombinant Expression Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.