Atlas Antibodies Anti-C3orf30 Antibody
Human C3orf30 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 RNA-seq 기반 Orthogonal 검증 완료. Recombinant PrEST 항원을 사용한 친화 정제. 인간에 특이적 반응성을 보이며 높은 신뢰도의 단백질 발현 분석에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-C3orf30 Antibody
Anti-C3orf30 Antibody
Target: chromosome 3 open reading frame 30 (C3orf30)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human C3orf30.
Alternative Gene Names
- FLJ32859
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 3 open reading frame 30 |
| Target Gene | C3orf30 |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000042555 (42%), Mouse ENSMUSG00000022798 (40%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
QAERRTSGQIDGRLAMPSDQRGSRQTDHRMAGQSERRASEQMDRRMSGEAERRTSEQITHRLSKLSERRPSVQIDSGSSVPSDQSP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.