
Atlas Antibodies Anti-C3orf30 Antibody
Human C3orf30 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 RNA-seq 기반 Orthogonal 검증 완료. Recombinant PrEST 항원을 사용한 친화 정제. 인간에 특이적 반응성을 보이며 높은 신뢰도의 단백질 발현 분석에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C3orf30 Antibody
Target: chromosome 3 open reading frame 30 (C3orf30)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human C3orf30.
Alternative Gene Names
- FLJ32859
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 3 open reading frame 30 |
| Target Gene | C3orf30 |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000042555 (42%), Mouse ENSMUSG00000022798 (40%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
QAERRTSGQIDGRLAMPSDQRGSRQTDHRMAGQSERRASEQMDRRMSGEAERRTSEQITHRLSKLSERRPSVQIDSGSSVPSDQSP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C3orf36 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf33 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf30 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C3orf18 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|