CacheBy
Atlas Antibodies Anti-C3orf30 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3orf30 Antibody

상품 한눈에 보기

Human C3orf30 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 RNA-seq 기반 Orthogonal 검증 완료. Recombinant PrEST 항원을 사용한 친화 정제. 인간에 특이적 반응성을 보이며 높은 신뢰도의 단백질 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062468-100 Anti-C3orf30 Antibody, chromosome 3 open reading frame 30 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062468-25 Anti-C3orf30 Antibody, chromosome 3 open reading frame 30 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3orf30 Antibody

Anti-C3orf30 Antibody

Target: chromosome 3 open reading frame 30 (C3orf30)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human C3orf30.


Alternative Gene Names

  • FLJ32859

Target Information

항목 내용
Target Protein chromosome 3 open reading frame 30
Target Gene C3orf30
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000042555 (42%), Mouse ENSMUSG00000022798 (40%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
QAERRTSGQIDGRLAMPSDQRGSRQTDHRMAGQSERRASEQMDRRMSGEAERRTSEQITHRLSKLSERRPSVQIDSGSSVPSDQSP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.