Atlas Antibodies Anti-C3orf22 Antibody

상품 한눈에 보기

인간 C3orf22 단백질을 타깃으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 제공. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제된 고품질 항체. Human 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059199-100 Anti-C3orf22 Antibody, chromosome 3 open reading frame 22 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059199-25 Anti-C3orf22 Antibody, chromosome 3 open reading frame 22 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Chromosome 3 open reading frame 22
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human C3orf22

항목	내용
Target Protein	Chromosome 3 open reading frame 22
Target Gene	C3orf22
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFT
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000025934 (56%), Mouse ENSMUSG00000049694 (49%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand