CacheBy
Atlas Antibodies Anti-C3orf33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3orf33 Antibody

상품 한눈에 보기

Human C3orf33 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 정제되었으며, 높은 종간 반응 특이성을 보유합니다. 안정적인 PBS/glycerol buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037663-100 Anti-C3orf33 Antibody, chromosome 3 open reading frame 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037663-25 Anti-C3orf33 Antibody, chromosome 3 open reading frame 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3orf33 Antibody

Anti-C3orf33 Antibody

Target: chromosome 3 open reading frame 33 (C3orf33)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C3orf33.


Alternative Gene Names

  • AC3-33
  • FLJ31139

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (PrEST antigen):
RLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQL


Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000048581 83%
Rat ENSRNOG00000021324 81%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.