CacheBy
Atlas Antibodies Anti-C3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3 Antibody

상품 한눈에 보기

인간 C3 단백질을 표적으로 하는 폴리클로날 항체로, 독립 항체 비교를 통한 IHC 검증 제공. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, Rat 및 Mouse와 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003563-100 Anti-C3 Antibody, complement component 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003563-25 Anti-C3 Antibody, complement component 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3 Antibody

Anti-C3 Antibody

Target Information

  • Target Protein: Complement component 3
  • Target Gene: C3
  • Alternative Gene Names: ARMD9, C3a, C3b, CPAMD1

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human C3.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000046834 78%
Mouse ENSMUSG00000024164 73%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.