CacheBy
Atlas Antibodies Anti-C2orf91 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf91 Antibody

상품 한눈에 보기

Human C2orf91 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 Affinity purification된 고품질 항체. Human에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042517-100 Anti-C2orf91 Antibody, chromosome 2 open reading frame 91 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042517-25 Anti-C2orf91 Antibody, chromosome 2 open reading frame 91 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf91 Antibody

Anti-C2orf91 Antibody

Target: Chromosome 2 open reading frame 91 (C2orf91)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human C2orf91

Open Datasheet


Target Information

항목 내용
Target Protein Chromosome 2 open reading frame 91
Target Gene C2orf91
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000017030 (33%), Mouse ENSMUSG00000032637 (31%)

Antigen Sequence:

ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.