CacheBy
Atlas Antibodies Anti-C3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3 Antibody

상품 한눈에 보기

Human C3 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 검증을 통해 신뢰성 높은 단백질 발현 확인에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. 다양한 연구 응용 분야에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020432-100 Anti-C3 Antibody, complement component 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020432-25 Anti-C3 Antibody, complement component 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3 Antibody

Anti-C3 Antibody

Target: Complement component 3 (C3)
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human C3.

Alternative Gene Names

ARMD9, C3a, C3b, CPAMD1

Open Datasheet

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000046834 78%
Mouse ENSMUSG00000024164 73%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.