Thermo Fisher Scientific ALDH2 Polyclonal Antibody
Thermo Fisher Scientific의 ALDH2 Polyclonal Antibody는 인간, 마우스, 랫트에 반응하는 토끼 유래 IgG 항체입니다. Western blot, IHC, ICC/IF에 사용 가능하며 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 2 µg/mL | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18–48aa: SAAATQAVPAPNQQPEVFCNQIFINNEWHDA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745873 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ALDH2는 aldehyde dehydrogenase 단백질군에 속하며, 알코올 대사 주요 산화 경로의 두 번째 효소입니다. 간에서 발견되는 두 가지 주요 isoform(세포질형과 미토콘드리아형)은 전기영동 이동도, 효소학적 특성, 세포 내 위치에 따라 구분됩니다. 대부분의 백인은 두 가지 isozyme을 가지지만 약 50%의 아시아인은 미토콘드리아 isozyme이 결여되어 있으며, 이는 알코올 급성 중독 빈도 증가와 관련이 있을 수 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ALOX12 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH7A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH1A3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AKR1B10 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|