CacheBy
Thermo Fisher Scientific ALDH7A1 Polyclonal Antibody
원본

Thermo Fisher Scientific ALDH7A1 Polyclonal Antibody

상품 한눈에 보기

ALDH7A1 단백질을 인식하는 Thermo Fisher의 토끼 폴리클로날 항체로, Western blot, IHC, ICC, Flow Cytometry에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용 전용 제품.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 10:05
Thermo Fisher Scientific PA578759 ALDH7A1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific ALDH7A1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunohistochemistry (Frozen) (IHC-F) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Detail
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333–369aa: ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2745875

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The ALDH7A1 gene encodes a member of the aldehyde dehydrogenase family, subfamily 7. These enzymes play a major role in detoxifying aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH7A1 is involved in lysine catabolism in the mitochondrial matrix and is found in both the cytosol and mitochondria, likely due to alternative translation initiation sites. Variants encoding different isoforms exist. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.