Thermo Fisher Scientific ALDH7A1 Polyclonal Antibody
ALDH7A1 단백질을 인식하는 Thermo Fisher의 토끼 폴리클로날 항체로, Western blot, IHC, ICC, Flow Cytometry에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용 전용 제품.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333–369aa: ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745875 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The ALDH7A1 gene encodes a member of the aldehyde dehydrogenase family, subfamily 7. These enzymes play a major role in detoxifying aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH7A1 is involved in lysine catabolism in the mitochondrial matrix and is found in both the cytosol and mitochondria, likely due to alternative translation initiation sites. Variants encoding different isoforms exist. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH3A2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ALOX12 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH7A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ALDH1A3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|