
원본
Thermo Fisher Scientific HMG4 Monoclonal Antibody (8H9)
상품 한눈에 보기
HMG4 단백질을 인식하는 mouse monoclonal antibody (clone 8H9). Western blot, ICC/IF, Flow cytometry 등 다양한 응용에 적합. 고순도 affinity chromatography로 정제된 lyophilized 형태. 인체, 마우스, 랫트 반응성.
- 카탈로그번호
- MA536241
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 05:43
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA536241 HMG4 Monoclonal Antibody (8H9) 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific HMG4 Monoclonal Antibody (8H9)
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 8H9 |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62–95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2884075 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of this subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly, and transcription.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
