
Thermo Fisher Scientific HMG4 Monoclonal Antibody (8H9)
HMG4 단백질을 인식하는 mouse monoclonal antibody (clone 8H9). Western blot, ICC/IF, Flow cytometry 등 다양한 응용에 적합. 고순도 affinity chromatography로 정제된 lyophilized 형태. 인체, 마우스, 랫트 반응성.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 8H9 |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62–95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2884075 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of this subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly, and transcription.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific HOMER3 Monoclonal Antibody (9G13)
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific UBA2 Monoclonal Antibody (5H11)
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific HMG4 Monoclonal Antibody (8H9)
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific MFN1 Monoclonal Antibody (3H3)
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific RP2 Monoclonal Antibody (3D7)
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|