원본

Thermo Fisher Scientific SI-CLP Polyclonal Antibody

상품 한눈에 보기

Human SI-CLP 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western blot 및 IHC(P) 실험에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, PBS/glycerol buffer에 보존됩니다. 연구용으로만 사용 가능합니다.

브랜드: Thermo Fisher Scientific
카테고리: Polyclonal Antibodies
판매단위: pk

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

마지막 업데이트 2025. 08. 05. 오후 09:40

카탈로그 번호 · 상품 설명출고판매가담기

Thermo Fisher Scientific PA558761 SI-CLP Polyclonal Antibody 100 ul pk판매 단위 pk ·

재고 확인 필요재고 확인 필요

773,300원VAT 포함 850,630원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Thermo Fisher Scientific · Thermo Fisher Scientific SI-CLP Polyclonal Antibody

Applications

Western Blot (WB)

Tested Dilution: 0.04–0.4 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

Tested Dilution: 1:20–1:50

Product Specifications

항목	내용
Species Reactivity	Human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	Recombinant protein corresponding to Human SI-CLP. Recombinant protein control fragment (Product #RP-97509)
Conjugate	Unconjugated
Form	Liquid
Concentration	0.05 mg/mL
Purification	Antigen affinity chromatography
Storage Buffer	PBS, pH 7.2, with 40% glycerol
Contains	0.02% sodium azide
Storage Conditions	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions	Wet ice
RRID	AB_2647297

Product Specific Information

Immunogen sequence:
KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV

Antigen sequence identity:

Mouse: 87%
Rat: 90%

Target Information

SI-CLP는 인간 Stabilin-interacting chitinase-like protein으로, Glyco-18 도메인 단백질 가족의 새로운 구성원입니다.
이 단백질은 활성화된 대식세포에서 interleukin-4 및 dexamethasone 반응으로 발현이 증가하며, T- 및 B-림프구, 단핵세포 및 상피세포에서도 발현됩니다.
SI-CLP는 stabilin-1의 리간드로 작용하며, 활성화된 대식세포에서 late endosome 및 secretory lysosome으로 분류됩니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

Thermo Fisher ScientificThermo Fisher Scientific AAGAB Polyclonal Antibody773,300원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific SPTY2D1 Polyclonal Antibody773,300원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific RNF6 Polyclonal Antibody773,300원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific FAM214A Polyclonal Antibody773,300원VAT별도

문의

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.