Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
Human IGFBP5 단백질에 특이적인 Rabbit Polyclonal Antibody. ICC/IF에 적합하며 항원 친화 크로마토그래피로 정제됨. PBS/glycerol buffer에 보관하며 장기 저장 시 -20°C 권장. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
Applications
- Immunocytochemistry (ICC/IF)
Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant Protein corresponding to Human IGFBP5. Recombinant protein control fragment (Product #RP-105988). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2856906 |
Product Specific Information
Immunogen sequence:DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
Target Information
The insulin-like growth factor-binding proteins (IGFBPs) are a family of homologous proteins that have co-evolved with the IGFs. They act as shuttle molecules for soluble IGFs and regulate IGF signaling by influencing bioavailability, concentration, and distribution in the extracellular environment.
IGFBPs also exhibit biological activity independent of IGFs. Seven IGFBPs have been identified, differing in tissue distribution, half-lives, and modulation of IGF interactions.
- IGFBP1 is negatively regulated by insulin and expressed during fetal liver development.
- IGFBP2 may function as a chaperone for IGFs, expressed in fetal eye and brain.
- IGFBP3 is the most abundant, complexed with ~80% of serum IGFs.
- IGFBP4 is released by fibroblasts upon injury.
- IGFBP5 is secreted by myoblasts and may play a key role in muscle differentiation.
Notes
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.