Thermo Fisher Scientific IGFBP5 Polyclonal Antibody

Thermo Fisher Scientific IGFBP5 Polyclonal Antibody

Applications

• Immunocytochemistry (ICC/IF)
  Tested Dilution: 0.25–2 µg/mL

Product Specifications

Product Specific Information

Immunogen sequence:
DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV

Target Information

The insulin-like growth factor-binding proteins (IGFBPs) are a family of homologous proteins that have co-evolved with the IGFs. They act as shuttle molecules for soluble IGFs and regulate IGF signaling by influencing bioavailability, concentration, and distribution in the extracellular environment.
IGFBPs also exhibit biological activity independent of IGFs. Seven IGFBPs have been identified, differing in tissue distribution, half-lives, and modulation of IGF interactions.

• IGFBP1 is negatively regulated by insulin and expressed during fetal liver development.
• IGFBP2 may function as a chaperone for IGFs, expressed in fetal eye and brain.
• IGFBP3 is the most abundant, complexed with ~80% of serum IGFs.
• IGFBP4 is released by fibroblasts upon injury.
• IGFBP5 is secreted by myoblasts and may play a key role in muscle differentiation.

Notes

For Research Use Only. Not for use in diagnostic procedures or resale without authorization.