
Thermo Fisher Scientific Ataxin 2 Polyclonal Antibody
Ataxin 2 단백질을 표적하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat에서 반응합니다. WB 및 IHC(P) 실험에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 재구성 시 500 µg/mL 농도를 유지합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- Publications: [References not provided]
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 2–5 µg/mL
- Publications: [References not provided]
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to C-terminus of human ATX2 (1283–1313aa: QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745962 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The autosomal dominant cerebellar ataxias (ADCA) are a group of neurodegenerative disorders involving progressive degeneration of the cerebellum, brain stem, and spinal cord. ADCA is divided into three types (I–III).
Defects in the Ataxin 2 gene cause spinocerebellar ataxia type 2 (SCA2), belonging to ADCA type I, characterized by cerebellar ataxia with additional symptoms such as optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy, and dementia.
SCA2 results from expansion of a CAG repeat in the coding region; longer expansions lead to earlier onset. Alternatively spliced transcript variants exist, though full-length sequences are undetermined.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(관련 항원 구조 이미지 및 제품 이미지 포함)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ATP5H Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|