Thermo Fisher Scientific Ataxin 2 Polyclonal Antibody
Ataxin 2 단백질을 표적하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat에서 반응합니다. WB 및 IHC(P) 실험에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 재구성 시 500 µg/mL 농도를 유지합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Ataxin 2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- Publications: [References not provided]
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 2–5 µg/mL
- Publications: [References not provided]
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to C-terminus of human ATX2 (1283–1313aa: QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745962 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The autosomal dominant cerebellar ataxias (ADCA) are a group of neurodegenerative disorders involving progressive degeneration of the cerebellum, brain stem, and spinal cord. ADCA is divided into three types (I–III).
Defects in the Ataxin 2 gene cause spinocerebellar ataxia type 2 (SCA2), belonging to ADCA type I, characterized by cerebellar ataxia with additional symptoms such as optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy, and dementia.
SCA2 results from expansion of a CAG repeat in the coding region; longer expansions lead to earlier onset. Alternatively spliced transcript variants exist, though full-length sequences are undetermined.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(관련 항원 구조 이미지 및 제품 이미지 포함)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.