Thermo Fisher Scientific CHAC2 Polyclonal Antibody
인간 CHAC2 단백질의 N-말단 영역을 표적으로 하는 Thermo Fisher Scientific의 rabbit polyclonal 항체입니다. Western blot에 적합하며, 고순도 affinity chromatography로 정제되었습니다. 액상 형태로 제공되며, 장기 보관 시 -20°C에서 보관 권장됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific CHAC2 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.2–1 µg/mL
Publications: -
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal region of human CHAC2 (aa 1–50) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2884587 |
Product Specific Information
- Immunogen sequence: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV
- Storage recommendation:
- Short term: 2–8°C up to 1 week
- Long term: -20°C in small aliquots to prevent freeze-thaw cycles
- Predicted homology:
Cow: 100% | Dog: 100% | Guinea Pig: 100% | Horse: 93% | Human: 100% | Mouse: 100% | Rabbit: 100% | Rat: 100% | Yeast: 92% | Zebrafish: 100%
Target Information
CHAC2 catalyzes the cleavage of glutathione into 5-oxoproline and a Cys-Gly dipeptide and acts specifically on glutathione, but not on other gamma-glutamyl peptides.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-114072_CHAC2_Q8WUX2-1_Rabbit.svg, PA5-114072_CHAC2_Q8WUX2-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ATP5D Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific UNC45A Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific CHAC2 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific SPNS2 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific ZDHHC24 Polyclonal Antibody
769,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|