원본
Thermo Fisher Scientific CHAC2 Polyclonal Antibody
상품 한눈에 보기
인간 CHAC2 단백질의 N-말단 영역을 표적으로 하는 Thermo Fisher Scientific의 rabbit polyclonal 항체입니다. Western blot에 적합하며, 고순도 affinity chromatography로 정제되었습니다. 액상 형태로 제공되며, 장기 보관 시 -20°C에서 보관 권장됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 06:47
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA5114072 CHAC2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific CHAC2 Polyclonal Antibody
Thermo Fisher Scientific CHAC2 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.2–1 µg/mL
Publications: -
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal region of human CHAC2 (aa 1–50) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2884587 |
Product Specific Information
- Immunogen sequence: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV
- Storage recommendation:
- Short term: 2–8°C up to 1 week
- Long term: -20°C in small aliquots to prevent freeze-thaw cycles
- Predicted homology:
Cow: 100% | Dog: 100% | Guinea Pig: 100% | Horse: 93% | Human: 100% | Mouse: 100% | Rabbit: 100% | Rat: 100% | Yeast: 92% | Zebrafish: 100%
Target Information
CHAC2 catalyzes the cleavage of glutathione into 5-oxoproline and a Cys-Gly dipeptide and acts specifically on glutathione, but not on other gamma-glutamyl peptides.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-114072_CHAC2_Q8WUX2-1_Rabbit.svg, PA5-114072_CHAC2_Q8WUX2-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific ATP5D Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific UNC45A Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SPNS2 Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ZDHHC24 Polyclonal Antibody769,400원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.