Thermo Fisher Scientific SH3BP2 Polyclonal Antibody
SH3BP2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, IHC, ICC/IF에 사용 가능. 인간 시료에 반응하며 항원 친화 크로마토그래피로 정제됨. PBS 기반 용액 형태로 제공되며, 4°C 단기 또는 -20°C 장기 보관 권장.
- 카탈로그번호
- PA557818
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SH3BP2 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:20–1:50 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human SH3BP2. Recombinant protein control fragment (Product #RP-96509). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.05 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2647236 |
Product Specific Information
Immunogen sequence:
LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY
Highest antigen sequence identity to the following orthologs:
- Mouse: 97%
- Rat: 95%
Target Information
The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. It binds to the SH3 domains of several proteins including ABL1 and SYK protein tyrosine kinases, functioning as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene are associated with cherubism. Multiple transcript variants encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.