CacheBy
Thermo Fisher Scientific SH3BP2 Polyclonal Antibody
원본

Thermo Fisher Scientific SH3BP2 Polyclonal Antibody

상품 한눈에 보기

SH3BP2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, IHC, ICC/IF에 사용 가능. 인간 시료에 반응하며 항원 친화 크로마토그래피로 정제됨. PBS 기반 용액 형태로 제공되며, 4°C 단기 또는 -20°C 장기 보관 권장.

카탈로그번호
PA557818
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 01:50
Thermo Fisher Scientific PA557818 SH3BP2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
773,300원VAT 포함 850,630원

Thermo Fisher Scientific · Thermo Fisher Scientific SH3BP2 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.04–0.4 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 1:20–1:50
Immunocytochemistry (ICC/IF) 0.25–2 µg/mL

Product Specifications

Specification Description
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant protein corresponding to Human SH3BP2. Recombinant protein control fragment (Product #RP-96509).
Conjugate Unconjugated
Form Liquid
Concentration 0.05 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.2, with 40% glycerol
Contains 0.02% sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2647236

Product Specific Information

Immunogen sequence:
LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY

Highest antigen sequence identity to the following orthologs:

  • Mouse: 97%
  • Rat: 95%

Target Information

The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. It binds to the SH3 domains of several proteins including ABL1 and SYK protein tyrosine kinases, functioning as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene are associated with cherubism. Multiple transcript variants encoding different isoforms have been identified.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.