Thermo Fisher Scientific SH3BP2 Polyclonal Antibody
SH3BP2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, IHC, ICC/IF에 사용 가능. 인간 시료에 반응하며 항원 친화 크로마토그래피로 정제됨. PBS 기반 용액 형태로 제공되며, 4°C 단기 또는 -20°C 장기 보관 권장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:20–1:50 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human SH3BP2. Recombinant protein control fragment (Product #RP-96509). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.05 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2647236 |
Product Specific Information
Immunogen sequence:
LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY
Highest antigen sequence identity to the following orthologs:
- Mouse: 97%
- Rat: 95%
Target Information
The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. It binds to the SH3 domains of several proteins including ABL1 and SYK protein tyrosine kinases, functioning as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene are associated with cherubism. Multiple transcript variants encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PPP1R21 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific HAT1 Polyclonal Antibody
799,600원
Thermo Fisher Scientific
Thermo Fisher Scientific SH3BP2 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific ZNF638 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific TTC7A Polyclonal Antibody
796,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|