Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
Human IGFBP5 단백질을 인식하는 Rabbit Polyclonal Antibody. Western blot과 ELISA에 사용 가능. 항원 친화 크로마토그래피로 정제된 동결건조 제품. 재구성 시 500 µg/mL 농도로 사용. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human IGFBP5 (76–114 aa, QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746570 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The insulin-like growth factor-binding proteins (IGFBPs) are a family of homologous proteins that have co-evolved with IGFs. They act as shuttle molecules for soluble IGFs and regulate IGF signaling by modulating bioavailability, concentration, and distribution in the extracellular environment. IGFBPs also exhibit IGF-independent biological activity. Seven IGFBPs have been identified, differing in tissue distribution, half-lives, and receptor interactions. IGFBP5, secreted by myoblasts, is believed to play a key role in muscle differentiation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.