CacheBy
Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
원본

Thermo Fisher Scientific IGFBP5 Polyclonal Antibody

상품 한눈에 보기

Human IGFBP5 단백질을 인식하는 Rabbit Polyclonal Antibody. Western blot과 ELISA에 사용 가능. 항원 친화 크로마토그래피로 정제된 동결건조 제품. 재구성 시 500 µg/mL 농도로 사용. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 09:22
Thermo Fisher Scientific PA579454 IGFBP5 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific IGFBP5 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
ELISA 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to human IGFBP5 (76–114 aa, QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746570

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The insulin-like growth factor-binding proteins (IGFBPs) are a family of homologous proteins that have co-evolved with IGFs. They act as shuttle molecules for soluble IGFs and regulate IGF signaling by modulating bioavailability, concentration, and distribution in the extracellular environment. IGFBPs also exhibit IGF-independent biological activity. Seven IGFBPs have been identified, differing in tissue distribution, half-lives, and receptor interactions. IGFBP5, secreted by myoblasts, is believed to play a key role in muscle differentiation.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.