Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
Human IGFBP5 단백질을 인식하는 Rabbit Polyclonal Antibody. Western blot과 ELISA에 사용 가능. 항원 친화 크로마토그래피로 정제된 동결건조 제품. 재구성 시 500 µg/mL 농도로 사용. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human IGFBP5 (76–114 aa, QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746570 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The insulin-like growth factor-binding proteins (IGFBPs) are a family of homologous proteins that have co-evolved with IGFs. They act as shuttle molecules for soluble IGFs and regulate IGF signaling by modulating bioavailability, concentration, and distribution in the extracellular environment. IGFBPs also exhibit IGF-independent biological activity. Seven IGFBPs have been identified, differing in tissue distribution, half-lives, and receptor interactions. IGFBP5, secreted by myoblasts, is believed to play a key role in muscle differentiation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IKK beta Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IHH Polyclonal Antibody
599,200원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|