
Atlas Antibodies Anti-PITPNB Antibody
Human PITPNB 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. 높은 종간 반응성(인간, 마우스, 랫트). PrEST 항원을 이용한 친화 정제 제품. 안정적인 PBS/glycerol buffer 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PITPNB Antibody
Target: phosphatidylinositol transfer protein, beta (PITPNB)
Type: Polyclonal Antibody against Human PITPNB
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
This polyclonal antibody is raised in rabbit against human PITPNB, a phosphatidylinositol transfer protein, beta. It has been affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- VIB1B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphatidylinositol transfer protein, beta |
| Target Gene | PITPNB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNT |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000050017 (99%)
- Rat ENSRNOG00000000665 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PITPNM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PITHD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PITPNB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIRT Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|