
Atlas Antibodies Anti-PIR Antibody
상품 한눈에 보기
Human PIR 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간 및 설치류 종에 반응합니다. RNA-seq 기반 직교 검증으로 신뢰성 높은 결과를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PIR Antibody
Target: pirin (iron-binding nuclear protein)
Type: Polyclonal Antibody against Human PIR
Recommended Applications
- IHC (Orthogonal validation using RNA-seq data comparison between high and low expression tissues)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against Human PIR.
Validated for multiple applications with enhanced validation standards.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pirin (iron-binding nuclear protein) |
| Target Gene | PIR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDF |
| Verified Species Reactivity | Human, Rat |
| Interspecies Information | Rat ENSRNOG00000003674 (97%), Mouse ENSMUSG00000031379 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PITHD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PITPNB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIRT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PITPNC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.