CacheBy
Atlas Antibodies Anti-PIRT Antibody
원본

Atlas Antibodies Anti-PIRT Antibody

상품 한눈에 보기

Human PIRT 단백질을 인식하는 토끼 폴리클로날 항체로, transient receptor potential 채널 조절 연구에 적합. PrEST 항원으로 정제되었으며, IHC 등 다양한 응용에 사용 가능. Human에 반응하며 Rat 및 Mouse와 높은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042337-100 Anti-PIRT Antibody, phosphoinositide-interacting regulator of transient receptor potential channels 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042337-25 Anti-PIRT Antibody, phosphoinositide-interacting regulator of transient receptor potential channels 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PIRT Antibody

Anti-PIRT Antibody

phosphoinositide-interacting regulator of transient receptor potential channels

면역조직화학(IHC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal Antibody against Human PIRT

Open Datasheet

Target Information

  • Target Protein: phosphoinositide-interacting regulator of transient receptor potential channels
  • Target Gene: PIRT
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    ETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000037852 90%
Mouse ENSMUSG00000048070 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.