
원본
Atlas Antibodies Anti-PIRT Antibody
상품 한눈에 보기
Human PIRT 단백질을 인식하는 토끼 폴리클로날 항체로, transient receptor potential 채널 조절 연구에 적합. PrEST 항원으로 정제되었으며, IHC 등 다양한 응용에 사용 가능. Human에 반응하며 Rat 및 Mouse와 높은 상동성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042337-100 Anti-PIRT Antibody, phosphoinositide-interacting regulator of transient receptor potential channels 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042337-25 Anti-PIRT Antibody, phosphoinositide-interacting regulator of transient receptor potential channels 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PIRT Antibody
Anti-PIRT Antibody
phosphoinositide-interacting regulator of transient receptor potential channels
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합
Product Description
Polyclonal Antibody against Human PIRT
Target Information
- Target Protein: phosphoinositide-interacting regulator of transient receptor potential channels
- Target Gene: PIRT
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000037852 | 90% |
| Mouse | ENSMUSG00000048070 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



