
Atlas Antibodies Anti-PGRMC2 Antibody
상품 한눈에 보기
Human PGRMC2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. DG6, PMBP 대체 유전자명으로도 알려져 있으며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증된 고품질 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PGRMC2 Antibody
Target: Progesterone receptor membrane component 2 (PGRMC2)
Type: Polyclonal antibody against Human PGRMC2
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting human PGRMC2, validated for multiple applications.
Alternative Gene Names
DG6, PMBP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Progesterone receptor membrane component 2 |
| Target Gene | PGRMC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (53%), Rat (50%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PHACTR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PHACTR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGRMC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGRMC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.