CacheBy
Atlas Antibodies Anti-PGRMC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGRMC2 Antibody

상품 한눈에 보기

Human PGRMC2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. DG6, PMBP 대체 유전자명으로도 알려져 있으며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증된 고품질 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058652-100 Anti-PGRMC2 Antibody, progesterone receptor membrane component 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058652-25 Anti-PGRMC2 Antibody, progesterone receptor membrane component 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGRMC2 Antibody

Anti-PGRMC2 Antibody

Target: Progesterone receptor membrane component 2 (PGRMC2)
Type: Polyclonal antibody against Human PGRMC2


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting human PGRMC2, validated for multiple applications.


Alternative Gene Names

DG6, PMBP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Progesterone receptor membrane component 2
Target Gene PGRMC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA
Verified Species Reactivity Human
Interspecies Identity Mouse (53%), Rat (50%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.