Atlas Antibodies Anti-PGRMC2 Antibody

상품 한눈에 보기

Human PGRMC2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. DG6, PMBP 대체 유전자명으로도 알려져 있으며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증된 고품질 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058652-100 Anti-PGRMC2 Antibody, progesterone receptor membrane component 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058652-25 Anti-PGRMC2 Antibody, progesterone receptor membrane component 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Progesterone receptor membrane component 2 (PGRMC2)
Type: Polyclonal antibody against Human PGRMC2

IHC (Immunohistochemistry)
WB (Western Blot, Independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody targeting human PGRMC2, validated for multiple applications.

DG6, PMBP

항목	내용
Target Protein	Progesterone receptor membrane component 2
Target Gene	PGRMC2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA
Verified Species Reactivity	Human
Interspecies Identity	Mouse (53%), Rat (50%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand