원본

Atlas Antibodies Anti-PHACTR1 Antibody

상품 한눈에 보기

인간 PHACTR1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal 검증을 통해 RNA-seq 데이터 기반 단백질 발현 확인이 가능합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029755-100 Anti-PHACTR1 Antibody, phosphatase and actin regulator 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029755-25 Anti-PHACTR1 Antibody, phosphatase and actin regulator 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

phosphatase and actin regulator 1

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Polyclonal antibody against human PHACTR1.

dJ257A7.2, KIAA1733, RPEL1

항목	내용
Target Protein	phosphatase and actin regulator 1
Target Gene	PHACTR1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PCSTSYHSSGLHSGDGVTKAGPMGLPEIRQVPTVVIECDDNKENVPHESDYEDSSCLYTREEEEEEEDEDDDSSLYTSS
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000014264 (94%), Mouse ENSMUSG00000054728 (92%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand