CacheBy
Atlas Antibodies Anti-PHACTR1 Antibody
원본

Atlas Antibodies Anti-PHACTR1 Antibody

상품 한눈에 보기

인간 PHACTR1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal 검증을 통해 RNA-seq 데이터 기반 단백질 발현 확인이 가능합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029755-100 Anti-PHACTR1 Antibody, phosphatase and actin regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029755-25 Anti-PHACTR1 Antibody, phosphatase and actin regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PHACTR1 Antibody

Anti-PHACTR1 Antibody

phosphatase and actin regulator 1

  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human PHACTR1.

Alternative Gene Names

dJ257A7.2, KIAA1733, RPEL1

Open Datasheet

Target Information

항목 내용
Target Protein phosphatase and actin regulator 1
Target Gene PHACTR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PCSTSYHSSGLHSGDGVTKAGPMGLPEIRQVPTVVIECDDNKENVPHESDYEDSSCLYTREEEEEEEDEDDDSSLYTSS
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000014264 (94%), Mouse ENSMUSG00000054728 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.