Atlas Antibodies Anti-PGRMC2 Antibody

상품 한눈에 보기

Human PGRMC2 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit에서 생산된 IgG 항체이며, 고순도 Affinity 정제 방식 적용. Human 반응성 검증 완료, 안정한 PBS/glycerol buffer로 보존.

카탈로그번호: HPA041172-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041172-100 Anti-PGRMC2 Antibody, progesterone receptor membrane component 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041172-25 Anti-PGRMC2 Antibody, progesterone receptor membrane component 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PGRMC2 Antibody

Anti-PGRMC2 Antibody

Target: Progesterone receptor membrane component 2 (PGRMC2)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) – Independent validation available
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PGRMC2

Alternative Gene Names

DG6, PMBP

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Progesterone receptor membrane component 2
Target Gene	PGRMC2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA
Verified Species Reactivity	Human
Interspecies Identity	Mouse (53%), Rat (50%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.