
Atlas Antibodies Anti-PGRMC2 Antibody
상품 한눈에 보기
Human PGRMC2 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit에서 생산된 IgG 항체이며, 고순도 Affinity 정제 방식 적용. Human 반응성 검증 완료, 안정한 PBS/glycerol buffer로 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PGRMC2 Antibody
Target: Progesterone receptor membrane component 2 (PGRMC2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent validation available
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human PGRMC2
Alternative Gene Names
DG6, PMBP
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Progesterone receptor membrane component 2 |
| Target Gene | PGRMC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (53%), Rat (50%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PGRMC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGRMC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGRMC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PGR Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.