CacheBy
Atlas Antibodies Anti-PGRMC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGRMC1 Antibody

상품 한눈에 보기

Human PGRMC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 등 다양한 응용에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트에 반응하며 고품질 단백질 발현 검증에 사용 가능.

카탈로그번호
HPA002877-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002877-100 Anti-PGRMC1 Antibody, progesterone receptor membrane component 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002877-25 Anti-PGRMC1 Antibody, progesterone receptor membrane component 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGRMC1 Antibody

Anti-PGRMC1 Antibody

Target: Progesterone receptor membrane component 1 (PGRMC1)
Supplier: Atlas Antibodies


  • Orthogonal validation using IHC: Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PGRMC1


Alternative Gene Names

  • HPR6.6

Target Information

항목 내용
Target Protein Progesterone receptor membrane component 1
Target Gene PGRMC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000006373 (97%)
Rat ENSRNOG00000012786 (95%)

Antigen Sequence:

DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.