CacheBy
Atlas Antibodies Anti-PGRMC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGRMC1 Antibody

상품 한눈에 보기

Human PGRMC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 등 다양한 응용에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트에 반응하며 고품질 단백질 발현 검증에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002877-100 Anti-PGRMC1 Antibody, progesterone receptor membrane component 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002877-25 Anti-PGRMC1 Antibody, progesterone receptor membrane component 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGRMC1 Antibody

Anti-PGRMC1 Antibody

Target: Progesterone receptor membrane component 1 (PGRMC1)
Supplier: Atlas Antibodies


  • Orthogonal validation using IHC: Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PGRMC1


Alternative Gene Names

  • HPR6.6

Target Information

항목 내용
Target Protein Progesterone receptor membrane component 1
Target Gene PGRMC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000006373 (97%)
Rat ENSRNOG00000012786 (95%)

Antigen Sequence:

DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.