AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PGP Antibody
상품 한눈에 보기
인간 PGP 단백질에 대한 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 단백질 발현 검증을 통해 높은 특이성과 신뢰성을 제공합니다. 토끼 유래 IgG이며, 친화 정제 방식으로 제조되었습니다.
- 카탈로그번호
- HPA043096-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043096-100 Anti-PGP Antibody, phosphoglycolate phosphatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043096-25 Anti-PGP Antibody, phosphoglycolate phosphatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGP Antibody
Anti-PGP Antibody
Target Protein: phosphoglycolate phosphatase (PGP)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human PGP.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINP
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000009536): 98%
- Mouse (ENSMUSG00000043445): 98%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.